Loading...
Statistics
Advertisement

The Lake Life : Celebrating Life On The Lake
www.the-lake-life.com/
The Lake Life celebrates living on the lake. Find gift ideas from top retailers of everything related to lakefront living and an outdoor lake life style

The-lake-life.com

Advertisement
Conversion Technology Metas Server
The-lake-life.com is hosted in United States / Orem . The-lake-life.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 5. First javascripts: 1442505827index.js, Adsbygoogle.js, Better-links-pr...racking.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 2. Its server type is: nginx/1.10.1. Its CMS is: Wordpress.

Technologies in use by The-lake-life.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 5
  • 1442505827index.js
  • adsbygoogle.js
  • better-links-pro-advanced-tracking.js
  • navigation.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • nginx/1.10.1

Used plugins, modules

Number of plugins and modules: 2
  • better links pro 1.1.1
  • better links pro advanced tracking

Google Analytics ID

  • UA-5732765-6

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - The-lake-life.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by BlueHost.Com, INC/OU=PositiveSSL Wildcard/CN=*.bluehost.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by BlueHost.Com, INC
        • 2: PositiveSSL Wildcard
      • CN: *.bluehost.com
    • hash: b00471fb
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 275919344465328667035358918366332841359
    • validFrom: 150313000000Z
    • validTo: 180312235959Z
    • validFrom_time_t: 1426204800
    • validTo_time_t: 1520899199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 29:B6:2F:A5:A8:41:C7:45:BE:86:84:10:E9:26:A7:94:67:64:BC:73
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.bluehost.com, DNS:bluehost.com

Meta - The-lake-life.com

Number of occurences: 14
  • Name:
    Content: http://www.the-lake-life.com/wp-content/uploads/2012/02/lucky-enough-4.jpg
  • Name: viewport
    Content: width=device-width
  • Name: description
    Content: The Lake Life celebrates living on the lake. Find gift ideas from top retailers of everything related to lakefront living and an outdoor lake life style
  • Name: keywords
    Content: The Lake Life, the-lake-life, lake-life, lake lifestyle, lake living, lake gifts, lake themed gifts
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: The Lake Life celebrates living on the lake. Find gift ideas from top retailers of everything related to lakefront living and an outdoor lake life style
  • Name: twitter:title
    Content: The Lake Life : Celebrating Life On The Lake
  • Name: twitter:site
    Content: @The_Lake_Life
  • Name: twitter:domain
    Content: The Lake Life
  • Name: twitter:image
    Content: http://www.the-lake-life.com/wp-content/uploads/2012/02/lucky-enough2-300x133.jpg
  • Name: twitter:creator
    Content: @The_Lake_Life
  • Name: msvalidate.01
    Content: F108B5DA00E22484111A2DE6F8FD971A
  • Name: google-site-verification
    Content: UA-5732765-6
  • Name: generator
    Content: WordPress 4.3.1

Server / Hosting

  • IP: 74.220.219.76
  • Latitude: 40.30
  • Longitude: -111.68
  • Country: United States
  • City: Orem

Rname

  • ns1.bluehost.com
  • ns2.bluehost.com
  • mail.the-lake-life.com

Target

  • dnsadmin.box476.bluehost.com

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Thu, 04 Aug 2016 00:50:22 GMT Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Transfer-Encoding: chunked Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive

DNS

host: the-lake-life.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 74.220.219.76
host: the-lake-life.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bluehost.com
host: the-lake-life.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bluehost.com
host: the-lake-life.com
  1. class: IN
  2. ttl: 66750
  3. type: SOA
  4. mname: ns1.bluehost.com
  5. rname: dnsadmin.box476.bluehost.com
  6. serial: 2015052001
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 300
host: the-lake-life.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.the-lake-life.com
host: the-lake-life.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:bluehost.com ?all
  5. entries: Array
host: the-lake-life.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: google-site-verification=aXDebWQh6WAqAkM5shcQ8YHCvuOaodY_UYDCf4haGcs
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.he-lake-life.com, www.tqhe-lake-life.com, www.qhe-lake-life.com, www.tahe-lake-life.com, www.ahe-lake-life.com, www.t he-lake-life.com, www. he-lake-life.com, www.twhe-lake-life.com, www.whe-lake-life.com, www.tehe-lake-life.com, www.ehe-lake-life.com, www.tzhe-lake-life.com, www.zhe-lake-life.com, www.txhe-lake-life.com, www.xhe-lake-life.com, www.tche-lake-life.com, www.che-lake-life.com, www.te-lake-life.com, www.thee-lake-life.com, www.tee-lake-life.com, www.thde-lake-life.com, www.tde-lake-life.com, www.thce-lake-life.com, www.tce-lake-life.com, www.thue-lake-life.com, www.tue-lake-life.com, www.thje-lake-life.com, www.tje-lake-life.com, www.the-lake-life.com, www.te-lake-life.com, www.thbe-lake-life.com, www.tbe-lake-life.com, www.thge-lake-life.com, www.tge-lake-life.com, www.th-lake-life.com, www.thex-lake-life.com, www.thx-lake-life.com, www.thes-lake-life.com, www.ths-lake-life.com, www.thew-lake-life.com, www.thw-lake-life.com, www.ther-lake-life.com, www.thr-lake-life.com, www.thef-lake-life.com, www.thf-lake-life.com, www.thev-lake-life.com, www.thv-lake-life.com, www.thec-lake-life.com, www.thc-lake-life.com, www.theq-lake-life.com, www.thq-lake-life.com, www.thea-lake-life.com, www.tha-lake-life.com, www.they-lake-life.com, www.thy-lake-life.com, www.thelake-life.com, www.the-tlake-life.com, www.thetlake-life.com, www.the-glake-life.com, www.theglake-life.com, www.the-hlake-life.com, www.thehlake-life.com, www.the-ulake-life.com, www.theulake-life.com, www.the-jlake-life.com, www.thejlake-life.com, www.the-xlake-life.com, www.thexlake-life.com, www.the-slake-life.com, www.theslake-life.com, www.the-alake-life.com, www.thealake-life.com, www.the-lake-life.com, www.thelake-life.com, www.the- lake-life.com, www.the lake-life.com, www.the-ake-life.com, www.the-luake-life.com, www.the-uake-life.com, www.the-l8ake-life.com, www.the-8ake-life.com, www.the-l9ake-life.com, www.the-9ake-life.com, www.the-ljake-life.com, www.the-jake-life.com, www.the-l0ake-life.com, www.the-0ake-life.com, www.the-lmake-life.com, www.the-make-life.com, www.the-lpake-life.com, www.the-pake-life.com, www.the-loake-life.com, www.the-oake-life.com, www.the-lke-life.com, www.the-laoke-life.com, www.the-loke-life.com, www.the-lapke-life.com, www.the-lpke-life.com, www.the-la9ke-life.com, www.the-l9ke-life.com, www.the-lake-life.com, www.the-lke-life.com, www.the-laike-life.com, www.the-like-life.com, www.the-lauke-life.com, www.the-luke-life.com, www.the-lae-life.com, www.the-lakte-life.com, www.the-late-life.com, www.the-lake-life.com, www.the-lae-life.com, www.the-lakge-life.com, www.the-lage-life.com, www.the-lakbe-life.com, www.the-labe-life.com, www.the-lakne-life.com, www.the-lane-life.com, www.the-lakhe-life.com, www.the-lahe-life.com, www.the-lakye-life.com, www.the-laye-life.com, www.the-lakle-life.com, www.the-lale-life.com, www.the-lakoe-life.com, www.the-laoe-life.com, www.the-lakue-life.com, www.the-laue-life.com, www.the-lakie-life.com, www.the-laie-life.com, www.the-lakme-life.com, www.the-lame-life.com, www.the-lak-life.com, www.the-lakex-life.com, www.the-lakx-life.com, www.the-lakes-life.com, www.the-laks-life.com, www.the-lakew-life.com, www.the-lakw-life.com, www.the-laker-life.com, www.the-lakr-life.com, www.the-lakef-life.com, www.the-lakf-life.com, www.the-lakev-life.com, www.the-lakv-life.com, www.the-lakec-life.com, www.the-lakc-life.com, www.the-lakeq-life.com, www.the-lakq-life.com, www.the-lakea-life.com, www.the-laka-life.com, www.the-lakey-life.com, www.the-laky-life.com, www.the-lakelife.com, www.the-lake-tlife.com, www.the-laketlife.com, www.the-lake-glife.com, www.the-lakeglife.com, www.the-lake-hlife.com, www.the-lakehlife.com, www.the-lake-ulife.com, www.the-lakeulife.com, www.the-lake-jlife.com, www.the-lakejlife.com, www.the-lake-xlife.com, www.the-lakexlife.com, www.the-lake-slife.com, www.the-lakeslife.com, www.the-lake-alife.com, www.the-lakealife.com, www.the-lake-life.com, www.the-lakelife.com, www.the-lake- life.com, www.the-lake life.com,

Other websites we recently analyzed

  1. AWAY REALTY | Лучшее агентство зарубежной недвижимости
    HOMES.RU - AWAY REALTY: Элитная зарубежная недвижимость, элитная недвижимость за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхаус, коттедж, таунхаус, особняк, дача, бунгало, офис, земля, земельный участок, страны мира, Европа, острова, экзотика, правовая информация, визы, описание страны по недвижимости, Австрия, Великобритания, Германия, Испания, Италия, Португалия, Франция, Хорватия, Черногория.
    Netherlands - 109.206.190.54
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 5
  2. Soltows Gaststätte und Partyservice | Essen außer Haus | Veranstaltungen
    Informationen zu Soltows Gaststätte und Partyservice
    Germany - 95.130.250.70
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 12
  3. Welcome to BESTRESTAURANTSINKEYWEST.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  4. OUTROXTREME
    Korea, Republic of - 183.111.174.8
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 1
  5. Leonardo Almeida | Sposen Realty & Development
    San Antonio (United States) - 67.192.7.83
    Server software: Apache
    Technology: Maxcdn, OSS CDN, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery Validate, jQuery UI, Php, Pingback, Wordpress
    Number of Javascript: 38
    Number of meta tags: 3
  6. 63355.xyz
    San Jose (United States) - 23.27.192.115
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. virgingalacticspaceflightsystems.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. cheaplouboutinsssstores.com
    Switzerland - 141.8.225.181
    Server software: nginx/1.9.2
    Technology: Html
  9. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
    Academia de Tênis de Mesa Especializada
    Houston (United States) - 192.185.217.48
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 12
    Number of meta tags: 5
  10. petalumahomesonline.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites